If you have been reading about melanocortin receptor and want a single page that covers the useful parts, this is it: definitions, context, how it is studied, and the questions that come up repeatedly.
Updated 2026-08-01. Numbers and descriptions here follow the published literature rather than marketing material.
Melanotan-2 is a synthetic peptide designed as an analog of alpha-melanocyte-stimulating hormone, a signaling molecule produced in the pituitary and skin. Its structure is a linear chain of seven amino acids that folds into a ring through an internal lactam bridge joining two side chains. The compound is sometimes written as MT-II or MEL-2 in informal and commercial contexts. It belongs to the melanocortin peptide family, a group of short signaling molecules that share a conserved core sequence recognized by melanocortin receptors.
Two structural changes distinguish the synthetic peptide from the natural hormone. A norleucine residue replaces methionine at one position, and a D-configured phenylalanine replaces the natural L-form at another. Both substitutions slow enzymatic breakdown, which extends the molecule's persistence relative to the parent hormone. The lactam bridge further constrains the backbone into a stable conformation. These features are standard design strategies in peptide chemistry and are not unique to this compound; they appear across many research peptides built for improved stability.
The compound was developed in the late 1980s and early 1990s by academic researchers investigating melanocortin signaling and pigmentation. Early work explored whether synthetic analogs could reproduce effects of the natural hormone under controlled conditions. The molecule never advanced through the full regulatory pathway required for approval as a medicine. From the mid-2000s onward it appeared in unregulated consumer markets, often distributed through informal channels. That gap between research origins and commercial availability shapes how the compound is discussed today.
The peptide acts as a non-selective agonist at melanocortin receptors, showing affinity for MC1R, MC3R, MC4R and MC5R. Activation of MC1R on melanocytes drives the conversion of tyrosine into melanin and shifts production toward the darker eumelanin form. MC4R signalling in the central nervous system is linked to appetite and energy balance, which helps explain why reduced food intake appeared in early human studies. Effects on MC4R and on vascular tone also account for the erectile responses recorded as unexpected findings in those same trials.
Melanotan-2 is frequently confused with afamelanotide, a linear analogue authorised in the European Union for erythropoietic protoporphyria. The two compounds differ in chain length, ring structure and receptor selectivity, so findings for one cannot be transferred directly to the other. Published controlled human data on melanotan-2 remain sparse, and much of what circulates online derives from small studies or unpublished reports. Questions about effect size, dose-response behaviour and long-term safety therefore remain unresolved.
| Property | Value | Notes |
|---|---|---|
| Molecular class | Synthetic cyclic heptapeptide | Analog of alpha-MSH with an internal lactam bridge |
| Molecular weight | Approximately 1024 daltons | Free base value; salt forms differ |
| Appearance | White to off-white powder | Usually supplied as a lyophilized solid |
| Solubility | Freely soluble in water | Poorly soluble in nonpolar solvents |
| Typical storage | −20 °C, dry, protected from light | Repeated freeze-thaw cycles degrade peptides |
=== Flagellate stage === The flagellated stage of N. fowleri is pear-shaped and biflagellate (with two flagella). This stage can be inhaled into the nasal cavity, typically during activities such as swimming or diving. The flagellate form develops when trophozoites are exposed to a change in ionic strength in the fluid where it is, such as being placed in distilled water. The flagellated form does not exist in human tissue, but can be present in the cerebrospinal fluid. Once inside the nasal cavity, the flagellated form transforms into a trophozoite within a few hours.
== Research == Treatments for ATTR-related neuropathy include TTR-specific oligonucleotides in the form of small interfering RNA (patisiran) or antisense inotersen, the former having recently received FDA approval. Research into treatments for ATTR amyloidosis have compared liver transplantation, oral drugs that stabilize the misfolding protein (including tafamidis and diflunisal), and newer therapeutic agents still being investigated (including patisiran). Based on available research, liver transplant remains the most effective treatment option for advanced ATTR amyloidosis, protein stabilizing drugs may slow disease progression but were insufficient to justify delay of liver transplant, and newer agents such as patisiran require additional studies.
==== Alpidem ==== Alpidem is a nonbenzodiazepine anxiolytic with similar anxiolytic effectiveness as benzodiazepines but reduced sedation and cognitive, memory, and motor impairment. It was marketed briefly in France but was withdrawn from the market due to liver toxicity.
== Chemistry == Bulevirtide is a 47-amino acid long lipopeptide with the following sequence: CH3(CH2)12CO-Gly-Thr-Asn-Leu-Ser-Val-Pro-Asn-Pro-Leu-Gly-Phe-Phe-Pro-Asp-His-Gln-Leu-Asp-Pro-Ala-Phe-Gly-Ala-Asn-Ser-Asn-Asn-Pro-Asp-Trp-Asp-Phe-Asn-Pro-Asn-Lys-Asp-His-Trp-Pro-Glu-Ala-Asn-Lys-Val-Gly-NH2 (C13H27CO-GTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANKVG-NH2)
Sources: en.wikipedia.org
Pure boron is a shiny, silver-grey crystalline solid. It is less dense than aluminium (2.34 vs. 2.70 g/cm3), and is hard and brittle. It is barely reactive under normal conditions, except for attack by fluorine, and has a melting point of 2076 °C (cf. steel ~1370 °C). Boron is a semiconductor; its room temperature electrical conductivity is 1.5 × 10−6 S•cm−1 (about 200 times less than that of tap water) and it has a band gap of about 1.56 eV. Mendeleev commented that, "Boron appears in a free state in several forms which are intermediate between the metals and the nonmmetals." The structural chemistry of boron is dominated by its small atomic size, and relatively high ionization energy. With only three valence electrons per boron atom, simple covalent bonding cannot fulfil the octet rule. Metallic bonding is the usual result among the heavier congeners of boron but this generally requires low ionization energies. Instead, because of its small size and high ionization energies, the basic structural unit of boron (and nearly all of its allotropes) is the icosahedral B12 cluster. Of the 36 electrons associated with 12 boron atoms, 26 reside in 13 delocalized molecular orbitals; the other 10 electrons are used to form two- and three-centre covalent bonds between icosahedra. The same motif can be seen, as are deltahedral variants or fragments, in metal borides and hydride derivatives, and in some halides. The bonding in boron has been described as being characteristic of behaviour intermediate between metals and nonmetallic covalent network solids (such as diamond).
==== Dairy consumption ==== It has been suggested that consumption of IGF1 in dairy products could increase cancer risk, particularly prostate cancer. However, significant levels of intact IGF1 from oral consumption are not absorbed as they are digested by gastric enzymes. IGF1 present in food is not expected to be active within the body in the way that IGF1 is produced by the body itself. The Food and Drug Administration has stated that IGF-I concentrations in milk are not significant when evaluated against concentrations of IGF-I endogenously produced in humans. A 2018 review by the Committee on Carcinogenicity of Chemicals in Food, Consumer Products and the Environment (COC) concluded that there is "insufficient evidence to draw any firm conclusions as to whether exposure to dietary IGF1 is associated with an increased incidence of cancer in consumers". Certain dairy processes such as fermentation are known to significantly decrease IGF1 concentrations. The British Dietetic Association has described the idea that milk promotes hormone related cancerous tumor growth as a myth, stating "no link between dairy containing diets and risk of cancer or promoting cancer growth as a result of hormones".
==== Interwar period and World War II (1918–1945) ==== During the interwar period, medical organizations and doctors in mainland Europe experimented with the idea of routine circumcision for prophylactic reasons as well, alongside developments in the Anglophonic world. In France, the medical profession went so far as to recommend universal routine circumcision. However, prevalence in France and mainland Europe remained low. There is a lack of consensus in the academic literature on why this occurred.
Several immunodeficiency syndromes present clinical and laboratory characteristics of autoimmunity. The decreased ability of the immune system to clear infections in these patients may be responsible for causing autoimmunity through perpetual immune system activation. One example is common variable immunodeficiency (CVID), where multiple autoimmune diseases are seen, e.g., inflammatory bowel disease, autoimmune thrombocytopenia, and autoimmune thyroid disease. Familial hemophagocytic lymphohistiocytosis, an autosomal recessive primary immunodeficiency, is another example. Low blood levels of red blood cells, white blood cells, and platelets, rashes, lymph node enlargement, and enlargement of the liver and spleen are commonly seen in these patients. The presence of multiple uncleared viral infections due to a lack of perforin is thought to be responsible. In addition to chronic and/or recurrent infections, many autoimmune diseases, including arthritis, autoimmune hemolytic anemia, scleroderma, and type 1 diabetes, are also seen in X-linked agammaglobulinemia (XLA). Recurrent bacterial and fungal infections and chronic inflammation of the gut and lungs are seen in chronic granulomatous disease (CGD). CGD is caused by a decreased production of nicotinamide adenine dinucleotide phosphate (NADPH) oxidase by neutrophils. Hypomorphic RAG mutations are seen in patients with midline granulomatous disease; an autoimmune disorder commonly occurring in patients with granulomatosis with polyangiitis and NK/T cell lymphomas.
== Advantages == In vitro studies allow a species-specific, simpler, more convenient, and more detailed analysis than can be done with the whole organism. Just as studies in whole animals more and more replace human trials, so are in vitro studies replacing studies in whole animals.
Sources: en.wikipedia.org
It is a synthetic seven-amino-acid peptide modeled on alpha-melanocyte-stimulating hormone. It carries two non-natural substitutions and a cyclic bridge that increase its stability relative to the natural hormone. It circulates as a research chemical and is not an approved medicine.
Melanotan-1, also called afamelanotide, is a shorter linear analog with a different amino acid sequence and no lactam ring. It has been evaluated in formal clinical programs, while melanotan-2 has not. The two are distinct molecules and are not interchangeable.
No. Bremelanotide is a related but distinct cyclic peptide that reached approved status for one specific clinical indication. Melanotan-2 is a separate molecule with its own sequence and properties. Shared ancestry in the melanocortin family does not make them the same substance.
It is a synthetic cyclic heptapeptide modelled on alpha-melanocyte-stimulating hormone. A lactam bridge links two side chains, forming a ring that stabilises the molecule against proteolysis. It belongs to the broader melanocortin peptide family.