melanocortin receptor is one of those subjects where the details matter more than the headlines. This page pulls together the background, the mechanisms, and the practical points readers ask about most.
Last reviewed on 2025-09-20. Where a claim depends on a specific study, the study is described rather than over-claimed.
Because the substance circulates mainly through informal markets, verification is a recurring theme in technical discussion. Independent analyses have found that labeled content and actual content can diverge, and that purity varies between samples. Analytical laboratories use reversed-phase chromatography to separate components and mass spectrometry to confirm identity. Isotope-labeled internal standards improve quantification in complex matrices. Such methods describe what a sample contains but say nothing about its sterility, lawful status, or suitability for any use. Open questions remain about how consistently testing is applied across the supply chain.
Regulatory treatment of this peptide varies by country. It holds no marketing authorization as a medicine in the United States, the European Union, or most other jurisdictions. Some countries classify products containing it as prescription-only or unlicensed medicines, which restricts lawful supply. Authorities have issued public notices warning that unregulated products may contain undeclared or incorrect ingredients. The molecule also appears on prohibited lists for competitive sport. These measures address supply oversight rather than any approved therapeutic role.
Melanotan-2 is frequently confused with afamelanotide, a linear analogue authorised in the European Union for erythropoietic protoporphyria. The two compounds differ in chain length, ring structure and receptor selectivity, so findings for one cannot be transferred directly to the other. Published controlled human data on melanotan-2 remain sparse, and much of what circulates online derives from small studies or unpublished reports. Questions about effect size, dose-response behaviour and long-term safety therefore remain unresolved.
Melanotan-2 is a synthetic cyclic heptapeptide designed as an analogue of alpha-melanocyte-stimulating hormone. Its sequence incorporates a lactam bridge that constrains the peptide into a ring, which increases resistance to enzymatic breakdown relative to the natural hormone. Researchers at the University of Arizona synthesised the compound in the late 1980s and early 1990s while studying pigmentation pathways. It has never received marketing approval from any national medicines regulator. In the scientific literature it is usually described as a laboratory research reagent rather than a therapeutic product.
| Property | Value | Notes |
|---|---|---|
| Regulatory status | Not approved as a medicine | No marketing authorization in major jurisdictions |
| Scheduling example | Prescription-only supply in some countries | Handled as an unlicensed medicine where restricted |
| Sports classification | Prohibited peptide | Appears on anti-doping prohibited lists |
| Reported presentation | Lyophilized vial | Nominal content varies between vendors |
| Detection approach | Liquid chromatography–tandem mass spectrometry | Used in anti-doping and forensic testing |
Identification in laboratories relies on reversed-phase liquid chromatography coupled with tandem mass spectrometry, with product-ion spectra compared against a certified reference standard. High-resolution mass spectrometry supplies accurate mass confirmation, and peptide mapping after enzymatic digestion separates melanotan II from closely related analogues. Quantitation of seized material is complicated by unknown counter-ions and residual trifluoroacetate left from purification. Immunoassays raised against alpha-melanocyte-stimulating hormone can cross-react, so chromatographic confirmation is normally required. Urinary detection windows are short, and reported limits of detection differ substantially between laboratories.
Melanotan II holds no marketing authorisation from the Food and Drug Administration, the European Medicines Agency, the UK Medicines and Healthcare products Regulatory Agency or Australia's Therapeutic Goods Administration. Products sold under that name are treated as unapproved new drugs, and their sale or import is prohibited in several jurisdictions. Other countries classify the peptide as a prescription-only medicine or place it among controlled substances, so the legal position changes with the destination market. No pharmacopoeial monograph supplies an official specification, because the material is not a licensed pharmaceutical. Consequently, products offered online are not manufactured to a shared public standard.
The peer-reviewed record is dominated by small early-phase studies, case reports and pharmacovigilance summaries rather than large randomised trials. Papers typically examine tanning response, receptor selectivity or patterns of reported adverse events. Many note that participants obtained the peptide outside a clinical setting, which limits verification of composition and administered amount. Reported events vary widely, and causality is frequently unclear because the identity and purity of self-sourced material are unknown. Open questions include whether repeated melanocortin receptor stimulation produces cumulative effects, and how often label claims match actual content.
Research interest has centred on photoprotection and pigmentation, with a smaller body of work on appetite and sexual function. Published human data remain limited to small, frequently uncontrolled studies, and the compound has never received marketing approval from a national medicines regulator. Most laboratory work treats it as a pharmacological tool for probing melanocortin signalling in cell culture or animal models. Whether pigmentation changes observed in people translate into measurable protection against ultraviolet-induced DNA damage remains an open question.
Melanotan-2 is a synthetic cyclic heptapeptide designed as an analogue of alpha-melanocyte-stimulating hormone, the naturally occurring peptide involved in pigmentation signalling. Its sequence is conventionally written as Ac-Nle-cyclo[Asp-His-D-Phe-Arg-Trp-Lys]-NH2, with a lactam bridge joining the aspartate side chain to the lysine side chain. The empirical formula is C50H69N15O9 and the monoisotopic mass lies near 1023.5 daltons. N-terminal acetylation and the D-configured phenylalanine both increase resistance to enzymatic breakdown compared with the parent hormone.
Pharmacologically, melanotan-2 behaves as a non-selective agonist across the melanocortin receptor family. Binding at MC1R on dermal melanocytes promotes eumelanin synthesis, which underlies the tanning response described in early human work. Activity at the centrally expressed MC4R receptor is associated with reported effects on appetite and erectile function. Because the peptide does not discriminate strongly among receptor subtypes, attributing any single observed effect to one receptor pathway is generally not possible without selective antagonists or receptor knockout models.
Verification of a purchased sample requires documentation linking a batch to a certificate of analysis, and that document should be read for the methods used rather than the headline purity figure. A single chromatographic percentage does not establish identity. Independent laboratories can perform identity and content assays, but no such test establishes that a product is suitable for human use. Claims about efficacy rest largely on small, early studies rather than on replicated controlled trials, and that gap remains open.
Identity testing for a cyclic peptide of this size usually relies on reversed-phase high-performance liquid chromatography coupled to mass spectrometry. The mass spectrum confirms molecular weight, while the chromatographic trace indicates the proportion of related impurities. Tandem mass spectrometry can provide sequence-level information when fragmentation data are compared against a reference standard. Nuclear magnetic resonance is sometimes used to confirm the lactam bridge, although it requires more material and greater operator expertise than routine chromatographic methods.
Lyophilised peptide powder is comparatively stable when kept dry, cold and protected from light. Once dissolved, the molecule is exposed to hydrolysis, oxidation and microbial growth, and degradation accelerates at higher temperatures and in alkaline solution. Repeated freeze-thaw cycles concentrate solutes and promote aggregation. Handling guidance for research peptides commonly clusters around freezer temperatures for powder and short refrigerated use for reconstituted solutions, with pH control and sterile technique applied throughout.
Human data remain limited and mostly short-term. Reports describe small trials and observational accounts rather than large controlled studies, so questions about dose-response relationships and long-term effects on melanocytes stay open. Whether repeated exposure alters naevus behaviour is not settled in the published record. Researchers also note that self-administered use outside clinical settings makes actual exposure difficult to quantify. Statements about efficacy and safety should therefore be read as preliminary rather than established.
Melanotan II is a synthetic cyclic heptapeptide that acts as an agonist at melanocortin receptors. It was designed as a structural analogue of alpha-melanocyte-stimulating hormone, the endogenous peptide involved in pigment production. The analogue carries a lactam bridge that constrains the ring and slows enzymatic breakdown relative to the native hormone. In research literature it appears under several abbreviations, and naming conventions are not fully standardized. Published descriptions usually place it within the broader melanocortin agonist family.
Receptor binding at MC1R on melanocytes raises intracellular cyclic AMP and increases expression of tyrosinase and related enzymes. The downstream result is greater synthesis of eumelanin, the dark pigment, without ultraviolet exposure acting as the trigger. The compound is not selective, however, and also engages MC3R, MC4R and MC5R, which are expressed in the central nervous system and elsewhere. That lack of selectivity is the explanation usually offered for effects reported outside pigmentation, including appetite suppression and nausea. Selectivity remains a central theme in comparative studies of related peptides.
Glycogen synthase kinase 3 (GSK-3) is a serine/threonine protein kinase that mediates the addition of phosphate molecules onto serine and threonine amino acid residues. First discovered in 1980 as a regulatory kinase for its namesake, glycogen synthase (GS), GSK-3 has since been identified as a protein kinase for over 100 different proteins in a variety of different pathways. In mammals, including humans, GSK-3 exists in two isozymes encoded by two homologous genes GSK-3α (GSK3A) and GSK-3β (GSK3B). GSK-3 has been the subject of much research since it has been implicated in a number of diseases, including type 2 diabetes, Alzheimer's disease, inflammation, cancer, addiction and bipolar disorder. GSK-3 is a serine/threonine protein kinase that phosphorylate either threonine or serine, and this phosphorylation controls a variety of biological activities, such as glycogen metabolism, cell signaling, cellular transport, and others. GS inhibition by GSK-3β leads to a decrease in glycogen synthesis in the liver and muscles, along with increased blood glucose or hyperglycemia. This is why GSK-3β is associated with the pathogenesis and progression of many diseases, such as diabetes, obesity, cancer, and Alzheimer's disease. It is active in resting cells and is inhibited by several hormones such as insulin, endothelial growth factor, and platelet-derived growth factor. Insulin indirectly inactivates GSK3 via downstream phosphorylation of the specific serine residues Ser21 and Ser9 in GSK-3 isoforms α and β, respectively via the PI3K/Akt pathway.
Napoleon defeated the Prussians at Jena-Auerstedt and the Russians at Friedland, bringing an uneasy peace to the continent by July 1807, and again leaving Britain as France's sole major enemy. Britain was unable to dispute French dominance on the continent but obtained hegemony over the seas after victories including Trafalgar. Russia used the interim peace to resolve wars with the Ottomans, Swedes, and Iranians. Hoping to isolate and weaken Britain economically through his Continental System, Napoleon launched an invasion of Portugal, the only remaining British ally in continental Europe. After occupying Lisbon in November 1807, and with the bulk of French troops present in Spain, Napoleon seized the opportunity to turn against his former ally, depose the reigning Spanish royal family, and declare his brother as Joseph I the King of Spain in 1808, to the disapproval of the Spanish populace. Spain joined Britain and Portugal, with the three powers engaging France in the Peninsular War. The diversion of French armies to the large new Anglo-Spanish front led to Austria reentering the conflict and forming the Fifth Coalition in April 1809, composed of Austria, Spain, and Britain. Austria won the Battle of Aspern-Essling but was defeated at Wagram, forcing the imposition of a harsh peace in October 1809. Britain, Spain, and Portugal remained at war with France. Concurrently Russia, unwilling to bear the economic consequences of reduced trade, violated the Continental System, prompting Napoleon to launch an invasion in June 1812.
RM + R'X → R–R' + MX As such, they have to be made by reacting alkylmercury compounds with sodium or potassium metal in inert hydrocarbon solvents. While methylsodium forms tetramers like methyllithium, methylpotassium is more ionic and has the nickel arsenide structure with discrete methyl anions and potassium cations. The alkali metals and their hydrides react with acidic hydrocarbons, for example cyclopentadienes and terminal alkynes, to give salts. Liquid ammonia, ether, or hydrocarbon solvents are used, the most common of which being tetrahydrofuran. The most important of these compounds is sodium cyclopentadienide, NaC5H5, an important precursor to many transition metal cyclopentadienyl derivatives. Similarly, the alkali metals react with cyclooctatetraene in tetrahydrofuran to give alkali metal cyclooctatetraenides; for example, dipotassium cyclooctatetraenide (K2C8H8) is an important precursor to many metal cyclooctatetraenyl derivatives, such as uranocene. The large and very weakly polarising alkali metal cations can stabilise large, aromatic, polarisable radical anions, such as the dark-green sodium naphthalenide, Na+[C10H8•]−, a strong reducing agent.
It was once widely promoted that excessive absinthe drinking caused effects that were discernible from those associated with alcoholism, a belief that led to the coining of the term absinthism. One of the first vilifications of absinthe followed an 1864 experiment in which Magnan simultaneously exposed one guinea pig to large doses of pure wormwood vapour, and another to alcohol vapours. The guinea pig exposed to wormwood vapour experienced convulsive seizures, while the animal exposed to alcohol did not. Magnan would later blame the naturally occurring (in wormwood) chemical thujone for these effects. Thujone, once widely believed to be an active chemical in absinthe, is a GABA antagonist, and while it can produce muscle spasms in large doses, there is no direct evidence to suggest it causes hallucinations. Past reports estimated thujone concentrations in absinthe as being up to 260 mg/kg. More recently, published scientific analyses of samples of various original absinthes have disproved previous estimates, and demonstrated that only a trace of the thujone present in wormwood actually makes it into a properly distilled absinthe when historical methods and materials are employed to create the spirit. As such, most traditionally crafted absinthes, both vintage and modern, fall within the current EU standards. Tests conducted on mice to study toxicity showed an oral LD50 of about 45 mg thujone per kg of body weight, which represents far more absinthe than could be realistically consumed.
== Synthesis == ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
Sources: en.wikipedia.org
=== Illegal gambling groups === Jogo do bicho (Animal game) is an illegal gambling game in Brazil, which is still incredibly popular and sought out despite its federal prohibition in 1946. The game is played all around the country, with lottery-style drawings in every state occurring daily in its headquarters in Greater Rio de Janeiro. The game is controlled by bosses, called bicheiros or banqueiros ("bankers"). Jogo do Bicho is a longstanding staple in Brazilian culture, with thousands participating in the game daily. Because of its potential to circulate and raise large sums of money, control of Jogo do Bicho is lucrative and largely contributes to corruption, with politicians, judicial personnel, and members of the police force all monetarily and politically benefitting from it. Bicheiros also contribute funding to social programs, such as samba schools, which play a critical role in cultural festivities such as Brazilian Carnival. Because of this, Jogo do Bicho, and in turn its bicheiros, are deeply ingrained in Brazilian culture, especially in Rio de Janeiro, and contribute to the landscape of organized crime and corruption.
A real/residual leak is due to an imperfect seal, a puncture, or some other hole in the system being tested. A virtual leak resembles a real leak but is caused by outgassing of chemicals trapped or adhered to the interior of the sealed system being tested. As the gases are released into the chamber, they can create a false positive indication of a real leak.
It is also used in the prevention of myringosclerosis, herpes simplex stromal keratitis. Topical prednisolone can also be used after procedures such as Laser Peripheral Iridotomy for patients with primary angle-closure suspects (PACS) to control inflammations. Ear drops In addition, topical prednisolone can also be administered as ear drops.
A gunshot wound to the neck can be particularly dangerous because of the high number of vital anatomical structures contained within a small space. The neck contains the larynx, trachea, pharynx, esophagus, vasculature (carotid, subclavian, and vertebral arteries; jugular, brachiocephalic, and vertebral veins; thyroid vessels), and nervous system anatomy (spinal cord, cranial nerves, peripheral nerves, sympathetic chain, brachial plexus). Gunshots to the neck can thus cause severe bleeding, airway compromise, and nervous system injury. Initial assessment of a gunshot wound to the neck involves non-probing inspection of whether the injury is a penetrating neck injury (PNI), classified by violation of the platysma muscle. If the platysma is intact, the wound is considered superficial and only requires local wound care. If the injury is a PNI, surgery should be consulted immediately while the case is being managed. Of note, wounds should not be explored on the field or in the emergency department given the risk of exacerbating the wound. Due to the advances in diagnostic imaging, management of PNI has been shifting from a "zone-based" approach, which uses anatomical site of injury to guide decisions, to a "no-zone" approach which uses a symptom-based algorithm. The no-zone approach uses a hard signs and imaging system to guide next steps. Hard signs include airway compromise, unresponsive shock, diminished pulses, uncontrolled bleeding, expanding hematoma, bruits/thrill, air bubbling from wound or extensive subcutaneous air, stridor/hoarseness, neurological deficits.
== Animal feed == Copra meal is used as fodder for horses and cattle. Its high oil and protein levels are fattening for stock. The protein in copra meal has been heat treated and provides a source of high-quality protein for cattle, sheep and deer, because it does not break down in the rumen. Coconut oil can be extracted using either mechanical expellers or solvents (hexane). Mechanically expelled copra meal is of higher feeding value, because it contains typically 8–12% oil, whereas the solvent-extracted copra meal contains only 2–4% oil. Premium quality copra meal can also contain 20–22% crude protein, and < 20ppb aflatoxin. High-quality copra meal contains < 12% non-structural carbohydrate (NSC), which makes it well suited for feeding to horses that are prone to ulcers, insulin resistance, colic, tying up, and acidosis.
Sources: en.wikipedia.org
Only a small number of early-stage human studies have been reported, and most were limited in size and duration. No large late-stage program has established a general efficacy or safety profile. The evidence base is therefore thin compared with approved medicines.
The peptide is listed as prohibited in competitive sport, so laboratories develop detection methods and monitor for its presence. Its appearance in enforcement reports reflects that classification rather than any approved athletic use. Analytical work in this area focuses on identifying the molecule and its breakdown products in biological samples.
Chromatographic separation combined with mass spectrometry identifies the peptide and estimates its amount in a sample. Testing can confirm whether the expected molecule is present and at what concentration. It cannot establish how a product was manufactured or whether it meets any purity standard.
It is a synthetic cyclic heptapeptide modelled on alpha-melanocyte-stimulating hormone. A lactam bridge links two side chains, forming a ring that stabilises the molecule against proteolysis. It belongs to the broader melanocortin peptide family.